PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo1G0082500
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family GATA
Protein Properties Length: 345aa    MW: 36153.5 Da    PI: 6.8962
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo1G0082500genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA55.76.7e-18249283135
            GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkgl 35 
                     C++C + kTp+WR gp g+ktLCnaCG++y++ +l
  Spipo1G0082500 249 CTHCSSEKTPQWRTGPLGPKTLCNACGVRYKSGRL 283
                     *******************************9885 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011411.596243279IPR000679Zinc finger, GATA-type
SMARTSM004011.9E-16243293IPR000679Zinc finger, GATA-type
Gene3DG3DSA:3.30.50.108.8E-14247281IPR013088Zinc finger, NHR/GATA-type
SuperFamilySSF577162.85E-14247307No hitNo description
CDDcd002025.74E-14248295No hitNo description
PfamPF003201.0E-15249283IPR000679Zinc finger, GATA-type
PROSITE patternPS003440249274IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MAPELDVGMG MGMGIGVGMM PMGIMGMDGG ASSSFSTAYL RSLPTTDGLP IDDLLDFSNQ  60
DDLFDSTVPG YAVESHQSHH PLPSHESAAP AVGSFDTCGS NLSTFSDDLY VPSEEAAELE  120
WLSKFVDDSF ADVPFPSSPG ACGNGLETLP SSISGGLRGD PSAIPGRARS KRSRAPAAAL  180
QHPTSTWSSS PAPPQPSSFS MSPTSSSSSL LEFPPCSATS KLKAAAAAAG GRKKETTAGP  240
GMESGVRRCT HCSSEKTPQW RTGPLGPKTL CNACGVRYKS GRLVPEYRPA ASPTFVLTQH  300
SNSHRKVMEL RRQKELVLRH HGGGPVATSP SSRPELLFHD YKVS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008796101.12e-80PREDICTED: GATA transcription factor 4-like
SwissprotO497411e-61GATA2_ARATH; GATA transcription factor 2
TrEMBLA0A0K9NN162e-77A0A0K9NN16_Z
STRINGGSMUA_Achr1P01570_0016e-70(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP46212955
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60530.15e-45GATA transcription factor 4